PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678470160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 303aa    MW: 33117.7 Da    PI: 7.9421
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678470160genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1048.8e-33194249156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W+peLH+rFv+a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  678470160 194 KARRCWSPELHRRFVQALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLH 249
                68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.4E-30191252IPR009057Homeodomain-like
PROSITE profilePS5129414.403191251IPR017930Myb domain
SuperFamilySSF466891.59E-18192252IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-27194249IPR006447Myb domain, plants
PfamPF002494.6E-8196247IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MNGHNHGDVS GKSRGCEGYI QALEEERRKI QVFQRELPLC LELVTQAIDS CKQQLSGTTA  60
EYNFNGQSEC NSDQTSTQTP VFEEFIPIKT TALSEEHELS NGDEHKKSDW LRSAQLWTSQ  120
TPDLVTRENS PRKVAVVEVG RSGAFHPFKK GKTNKDGGSV TTSPREAPSI SPPAAATDGG  180
AAKKDDKEGQ AQRKARRCWS PELHRRFVQA LQQLGGSHAA TPKQIRELMK VDGLTNDEVK  240
SHLQKYRLHT RRPSPTIQSS TANPPPQFAV VVGGIWAMPP EYATVATSGE VGSGVAVASN  300
EIX
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070832.11e-126PREDICTED: uncharacterized protein LOC105156412
TrEMBLD7T9871e-115D7T987_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g03110.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.12e-81G2-like family protein